Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SFXN3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SFXN3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159728
|
Novus Biologicals
NBP159728 |
100 μL |
Each of 1 for $436.00
|
|
Description
SFXN3 Polyclonal specifically detects SFXN3 in Human samples. It is validated for Western Blot.Specifications
SFXN3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
81855 | |
Synthetic peptides corresponding to SFXN3(sideroflexin 3) The peptide sequence was selected from the middle region of SFXN3. Peptide sequence TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
BA108L7.2, SFX3, sideroflexin 3, sideroflexin-3 | |
SFXN3 | |
IgG | |
Affinity Purified | |
36 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title