Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SFXN4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP24135420UL

 View more versions of this product

Catalog No. NBP24135420

Add to cart



SFXN4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Western Blot 1:100-1:2000
BCRM1, Breast cancer resistance marker 1, sideroflexin 4, sideroflexin-4
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to SFXN4 (sideroflexin 4) The peptide sequence was selected from the N terminal of SFXN4. Peptide sequence: MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELL.
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit