Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SGCE Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | SGCE |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159794
|
Novus Biologicals
NBP159794 |
100 μL |
Each of 1 for $436.00
|
N/A |
Description
epsilon-Sarcoglycan Polyclonal specifically detects epsilon-Sarcoglycan in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SGCE | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
8910 | |
Synthetic peptides corresponding to SGCE(sarcoglycan, epsilon) The peptide sequence was selected from the N terminal of SGCE. Peptide sequence TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
dystonia 11, myoclonic, DYT11, epsilon-sarcoglycan, Epsilon-SG, ESG, sarcoglycan, epsilon | |
SGCE | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title