Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SgK071 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155182

 View more versions of this product

Catalog No. NBP155182

Add to cart



SgK071 Polyclonal antibody specifically detects SgK071 in Human, Rat, Bovine, Canine, Equine, Guinea Pig samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to SgK071 The peptide sequence was selected from the C terminal of SgK071. Peptide sequence AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE.
76 kDa
Protein Kinase
Bovine, Canine, Equine, Guinea Pig, Human, Rat
Western Blot
Western Blot 1:100-1:2000
chromosome 9 open reading frame 96, MGC43306, protein kinase-like protein SgK071, RP11-244N20.8, SgK071, Sk521, Sugen kinase 071
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit