SH3BP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP258311

Catalog No. NBP258311

Description

SH3BP5 Polyclonal antibody specifically detects SH3BP5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SH3BP5
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Alias: Sab, SABSH3BP-5, SH3 binding protein, SH3 domain-binding protein 5, SH3 domain-binding protein that preferentially associates with BTK, SH3-domain binding protein 5 (BTK-associated)
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 100 ul
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Format: Affinity Purified
• Gene Symbols: SH3BP5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9467
• Target Species: Human

For Research Use Only