Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SH3GL3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP288264

Catalog No. NB035886


Add to cart

Description

Description

SH3GL3 Polyclonal specifically detects SH3GL3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SH3GL3
Unconjugated
PBS, 2% Sucrose
CNSA3, EEN-B2, endophilin-A3, SH3D2C, SH3-domain GRB2-like 3
The immunogen is a synthetic peptide directed towards the middle region of Human SH3GL3. Peptide Sequence EAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNG. The peptide sequence for this immunogen was taken from within the described region.
100 μg
Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Immunogen affinity purified
RUO
Primary
6457
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit