SH3GL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP179630

Catalog No. NBP179630

Description

SH3GL3 Polyclonal specifically detects SH3GL3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SH3GL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CNSA3, EEN-B2, endophilin-A3, SH3D2C, SH3-domain GRB2-like 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_059096
• Gene Symbols: SH3GL3
• Immunogen: Synthetic peptide directed towards the middle region of human Sh3gl3The immunogen for this antibody is Sh3gl3. Peptide sequence IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6457
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.