Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SHC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258795

Catalog No. NBP258795


Add to cart

Description

Description

SHC3 Polyclonal antibody specifically detects SHC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

SHC3
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transforming protein C, src homology 2 domain-containing transforming protein C3, Src homology 2 domain-containing-transforming protein C3
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
SHC3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HPYYNSIPSKMPPPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPP
Affinity purified
RUO
Primary
53358
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only