Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SHC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen SHC4
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123934
View Documents
Novus Biologicals
NBP30951625UL
25 μg N/A
NB123933
View Documents
Novus Biologicals
NBP309516100UL
100 μg N/A
Description

Description

SHC4 Polyclonal antibody specifically detects SHC4 in Human samples. It is validated for Western Blot
Specifications

Specifications

SHC4
Western Blot
Purified
RUO
Human
hShcD, MGC34023, Rai-like protein, RaLPSH2 domain protein C4, SHC (Src homology 2 domain containing) family, member 4, SHCD, SHC-transforming protein 4, SHC-transforming protein D, Src homology 2 domain-containing-transforming protein C4
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHC4 (NP_976224). Peptide sequence NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
399694
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit