Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SHC4 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB123933
|
Novus Biologicals
NBP309516100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
SHC4 Polyclonal specifically detects SHC4 in Human samples. It is validated for Western Blot.Specifications
SHC4 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS buffer, 2% sucrose | |
399694 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
hShcD, MGC34023, Rai-like protein, RaLPSH2 domain protein C4, SHC (Src homology 2 domain containing) family, member 4, SHCD, SHC-transforming protein 4, SHC-transforming protein D, Src homology 2 domain-containing-transforming protein C4 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHC4 (NP_976224). Peptide sequence NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title