Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SHCBP1L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP288269

Catalog No. NB035891

Add to cart



SHCBP1L Polyclonal specifically detects SHCBP1L in Human samples. It is validated for Western Blot.


PBS, 2% Sucrose
C1orf14, GE36, MGC26911, SHC SH2 domain-binding protein 1-like protein, SHC SH2-domain binding protein 1-like
The immunogen is a synthetic peptide directed towards the middle region of human SHCBP1L. Peptide Sequence IAQRFKKTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCG. The peptide sequence for this immunogen was taken from within the described region.
100 μg
Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1.0 ug/ml
Immunogen affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit