Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHPRH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SHPRH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157190
|
Novus Biologicals
NBP157190 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SHPRH Polyclonal specifically detects SHPRH in Human samples. It is validated for Western Blot.Specifications
| SHPRH | |
| Polyclonal | |
| Rabbit | |
| DNA Repair | |
| 2610103K11Rik, bA545I5.2, E3 ubiquitin-protein ligase SHPRH, EC 3.6.4.-, EC 6.3.2.-, FLJ27258, FLJ37625, FLJ90837, histone-linker, PHD and RING finger domain-containing helicase, KIAA2023FLJ45012, MGC134886, SNF2 histone linker PHD RING helicase | |
| SHPRH | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q149N8-4 | |
| 257218 | |
| Synthetic peptides corresponding to SHPRH(SNF2 histone linker PHD RING helicase) Antibody(against the N terminal of SHPRH. Peptide sequence SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title