Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SIN3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	SIN3B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP180222 View Documents View Product Certificates	Novus Biologicals NBP180222	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SIN3B Polyclonal specifically detects SIN3B in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	SIN3B
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b
Gene Symbols	SIN3B
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	NP_033214
Gene ID (Entrez)	23309
Immunogen	Synthetic peptide directed towards the N terminal of human SIN3B. Peptide sequence NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV.
Primary or Secondary	Primary
Molecular Weight of Antigen	105 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SIN3B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents