Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SIX1 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SIX1
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP182401
View Documents
Novus Biologicals
NBP182401
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SIX1 Polyclonal specifically detects SIX1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

SIX1
Unconjugated
RUO
BOS3, deafness, autosomal dominant 23, DFNA23, homeobox protein SIX1, sine oculis homeobox (Drosophila) homolog 1, Sine oculis homeobox homolog 1, sine oculis homeobox homolog 1 (Drosophila), SIX homeobox 1, TIP39
SIX1
IgG
Affinity Purified
Polyclonal
Rabbit
NP_033215
6495
Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit