Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SIX1 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SIX1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP182401
|
Novus Biologicals
NBP182401 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SIX1 Polyclonal specifically detects SIX1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SIX1 | |
| Unconjugated | |
| RUO | |
| BOS3, deafness, autosomal dominant 23, DFNA23, homeobox protein SIX1, sine oculis homeobox (Drosophila) homolog 1, Sine oculis homeobox homolog 1, sine oculis homeobox homolog 1 (Drosophila), SIX homeobox 1, TIP39 | |
| SIX1 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| NP_033215 | |
| 6495 | |
| Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title