Invitrogen™ SIX3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595466

Catalog No. PIPA595466

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the sine oculis homeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in this gene have been associated with holoprosencephaly type 2.

Specifications

• Antigen: SIX3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Six3
• Gene Alias: E130112M24Rik; Homeobox protein SIX3; HPE2; sine oculis homeobox 3-like protein; sine oculis homeobox homolog 3; sine oculis homeobox-like protein 3; sine oculis-related homeobox 3; sine oculis-related homeobox 3 homolog; SIX homeobox 3; Six3; Six3a; Six3alpha; Six3b; Six3beta
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 20473, 6496, 78974
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O95343, Q62233
• Gene Symbols: Six3
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Six3 (1-32aa MVFRSPLDLYSSHFLLPNFADSHHRSILLASS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov