Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC10A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17931620UL
Description
SLC10A3 Polyclonal specifically detects SLC10A3 in Human samples. It is validated for Western Blot.Specifications
SLC10A3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_062822 | |
SLC10A3 | |
Synthetic peptide directed towards the middle region of human SLC10A3The immunogen for this antibody is SLC10A3. Peptide sequence MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
solute carrier family 10 (sodium/bile acid cotransporter family), member 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
8273 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title