Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC10A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SLC10A3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17931620
View Documents
Novus Biologicals
NBP17931620UL
20 μL
Each for $152.22
Add to cart
 
NBP179316
View Documents
Novus Biologicals
NBP179316
100 μL
Each for $436.00
Add to cart
 
Description

Description

SLC10A3 Polyclonal specifically detects SLC10A3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC10A3
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
solute carrier family 10 (sodium/bile acid cotransporter family), member 3
SLC10A3
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_062822
8273
Synthetic peptide directed towards the middle region of human SLC10A3The immunogen for this antibody is SLC10A3. Peptide sequence MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit