Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC10A7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | SLC10A7 |
|---|---|
| Immunogen | Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7) The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSF |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15987520 |
Novus Biologicals
NBP15987520UL |
20ul |
Each for $149.00
|
|
NBP159875 |
Novus Biologicals
NBP159875 |
100 ul |
Each for $329.00
|
|
Description
SLC10A7 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| SLC10A7 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 84068 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7) The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSF | |
| Primary | |
| IgG | |
| C4orf13, chromosome 4 open reading frame 13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043, Na(+)/bile acid cotransporter 7, P7, SBF-domain containing protein, sodium/bile acid cotransporter 7, solute carrier family 10 (sodium/bile acid cotransporter family), member 7, Solute carrier family 10 member 7 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title