Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC22A24 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SLC22A24 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156814
|
Novus Biologicals
NBP156814 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SLC22A24 Polyclonal specifically detects SLC22A24 in Human samples. It is validated for Western Blot.Specifications
| SLC22A24 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C9JC66 | |
| 283238 | |
| Synthetic peptides corresponding to MGC34821 The peptide sequence was selected from the middle region of MGC34821. Peptide sequence VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC34821, NET46, solute carrier family 22 member 24, solute carrier family 22, member 24 | |
| SLC22A24 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title