Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC22A24 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SLC22A24
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156814
View Documents
Novus Biologicals
NBP156814
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SLC22A24 Polyclonal specifically detects SLC22A24 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC22A24
Polyclonal
Rabbit
Human
C9JC66
283238
Synthetic peptides corresponding to MGC34821 The peptide sequence was selected from the middle region of MGC34821. Peptide sequence VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
MGC34821, NET46, solute carrier family 22 member 24, solute carrier family 22, member 24
SLC22A24
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit