Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A24 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen SLC25A24
Immunogen Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the N terminal of SLC25A24. Peptide sequence MDSLYGDLFWYLDYNKDGTLDIFELQEGLE
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15955720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15955720UL
20ul Each for $149.00
Add to cart
 
NBP159557 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159557
100 ul Each for $329.00
Add to cart
 
Description

Description

SLC25A24 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SLC25A24
Rabbit
Polyclonal
Unconjugated
29957
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the N terminal of SLC25A24. Peptide sequence MDSLYGDLFWYLDYNKDGTLDIFELQEGLE
Primary
IgG
APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit