Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A28 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15956720UL
Description
SLC25A28 Polyclonal specifically detects SLC25A28 in Human samples. It is validated for Western Blot.Specifications
| SLC25A28 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q96A46 | |
| SLC25A28 | |
| Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the middle region of SLC25A28. Peptide sequence VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 81894 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title