Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A28 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SLC25A28
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15956720
View Documents
Novus Biologicals
NBP15956720UL
20 μL
Each for $152.22
Add to cart
 
NBP159567
View Documents
Novus Biologicals
NBP159567
100 μL
Each for $436.00
Add to cart
 
Description

Description

SLC25A28 Polyclonal specifically detects SLC25A28 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC25A28
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28
SLC25A28
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q96A46
81894
Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the middle region of SLC25A28. Peptide sequence VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit