Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A29 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SLC25A29 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15949920
|
Novus Biologicals
NBP15949920UL |
20 μL |
Each for $152.22
|
|
NBP159499
|
Novus Biologicals
NBP159499 |
100 μL |
Each for $436.00
|
|
Description
SLC25A29 Polyclonal specifically detects SLC25A29 in Human samples. It is validated for Western Blot.Specifications
| SLC25A29 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q8N8R3 | |
| 123096 | |
| Synthetic peptides corresponding to SLC25A29(solute carrier family 25, member 29) The peptide sequence was selected from the C terminal of SLC25A29. Peptide sequence AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C14orf69, CACL, CACT-like, carnitine-acylcarnitine translocase like, chromosome 14 open reading frame 69, FLJ38975, mitochondrial carnitine/acylcarnitine carrier protein CACL, Solute carrier family 25 member 29, solute carrier family 25, member 29 | |
| SLC25A29 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title