SLC25A31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159561

Catalog No. NBP159561

Description

SLC25A31 Polyclonal specifically detects SLC25A31 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC25A31
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AAC4DKFZp434N1235, adenine nucleotide translocase 4, Adenine nucleotide translocator 4, ADP, ADP/ATP translocase 4, ANT 4, ANT4DKFZP434N1235, ATP carrier protein 4, SFEC, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83447
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H0C2
• Gene Symbols: SLC25A31
• Immunogen: Synthetic peptides corresponding to SLC25A31(solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31) The peptide sequence was selected from the N terminal of SLC25A31. Peptide sequence LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Canine: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG