Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A39 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SLC25A39
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15960020
View Documents
Novus Biologicals
NBP15960020UL
20 μL
Each for $152.22
Add to cart
 
NBP159600
View Documents
Novus Biologicals
NBP159600
100 μL
Each for $436.00
Add to cart
 
Description

Description

SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

SLC25A39
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39
SLC25A39
IgG
Affinity Purified
39 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Q9BZJ4
51629
Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit