Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A39 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SLC25A39 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15960020
|
Novus Biologicals
NBP15960020UL |
20 μL |
Each for $152.22
|
|
NBP159600
|
Novus Biologicals
NBP159600 |
100 μL |
Each for $436.00
|
|
Description
SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC25A39 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39 | |
| SLC25A39 | |
| IgG | |
| Affinity Purified | |
| 39 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q9BZJ4 | |
| 51629 | |
| Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title