Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A48 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SLC25A48 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17951520
|
Novus Biologicals
NBP17951520UL |
20 μL |
Each for $152.22
|
|
NBP179515
|
Novus Biologicals
NBP179515 |
100 μL |
Each for $436.00
|
|
Description
SLC25A48 Polyclonal specifically detects SLC25A48 in Human samples. It is validated for Western Blot.Specifications
| SLC25A48 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| BAC86705 | |
| 153328 | |
| Synthetic peptide directed towards the c terminal of human LOC153328. Peptide sequence TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ44862, HCC-down-regulated mitochondrial carrier protein, HDMCP, solute carrier family 25 member 48, solute carrier family 25, member 48 | |
| SLC25A48 | |
| IgG | |
| Affinity Purified | |
| 31 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title