Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC26A2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18052220UL

 View more versions of this product

Catalog No. NBP18052220


Add to Cart

Description

Description

SLC26A2 Polyclonal specifically detects SLC26A2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

SLC26A2
Polyclonal
Western Blot 1:1000
NP_031911
SLC26A2
Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA.
20 μL
Primary
Mouse
IgG
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter
Rabbit
Affinity Purified
RUO
1836
Store at -20C. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit