SLC26A2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180522

Catalog No. NBP180522

Description

SLC26A2 Polyclonal specifically detects SLC26A2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SLC26A2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_031911
• Gene Symbols: SLC26A2
• Immunogen: Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Mouse: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1836
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.