Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC26A2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SLC26A2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18052220
|
Novus Biologicals
NBP18052220UL |
20 μL |
Each for $152.22
|
|
NBP180522
|
Novus Biologicals
NBP180522 |
100 μL |
Each for $436.00
|
|
Description
SLC26A2 Polyclonal specifically detects SLC26A2 in Mouse samples. It is validated for Western Blot.Specifications
| SLC26A2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter | |
| SLC26A2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_031911 | |
| 1836 | |
| Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title