Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC35D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30953425UL

 View more versions of this product

Catalog No. NB123970


Add to cart

Description

Description

SLC35D1 Polyclonal specifically detects SLC35D1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC35D1
Unconjugated
PBS buffer, 2% sucrose
KIAA0260MGC138236, solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dualtransporter), member D1, Solute carrier family 35 member D1, UDP-galactose transporter-related protein 7, UDP-GlcA/UDP-GalNAc transporter, UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter, UGTrel7, UGTREL7UDP-galactose transporter-related 7
The immunogen is a synthetic peptide directed towards the middle region of human SLC35D1 (NP_055954.1). Peptide sequence SDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFM
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
23169
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit