Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC35D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen SLC35D1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123970
View Documents
Novus Biologicals
NBP30953425UL
25 μg
Each for $106.19
Add to cart
 
NB123969
View Documents
Novus Biologicals
NBP309534100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

SLC35D1 Polyclonal antibody specifically detects SLC35D1 in Human samples. It is validated for Western Blot
Specifications

Specifications

SLC35D1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
23169
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
KIAA0260MGC138236, solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dualtransporter), member D1, Solute carrier family 35 member D1, UDP-galactose transporter-related protein 7, UDP-GlcA/UDP-GalNAc transporter, UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter, UGTrel7, UGTREL7UDP-galactose transporter-related 7
The immunogen is a synthetic peptide directed towards the middle region of human SLC35D1 (NP_055954.1). Peptide sequence SDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFM
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit