Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC35F2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258197

Catalog No. NBP258197


Add to cart

Description

Description

SLC35F2 Polyclonal antibody specifically detects SLC35F2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

SLC35F2
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
DKFZp667H1615, FLJ13018, HSNOV1, lung squamous cell cancer related protein LSCC-3, solute carrier family 35 member F2, solute carrier family 35, member F2
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
SLC35F2
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN
Affinity purified
RUO
Primary
54733
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only