Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC39A10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | SLC39A10 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126051
|
Novus Biologicals
NBP310575100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
SLC39A10 Polyclonal specifically detects SLC39A10 in Human samples. It is validated for Western Blot.Specifications
| SLC39A10 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp564L2123, DKFZp781L10106, FLJ90515, KIAA1265, LZT-Hs2, MGC126565, MGC138428, solute carrier family 39 (metal ion transporter), member 10, solute carrier family 39 (zinc transporter), member 10, Solute carrier family 39 member 10, zinc transporter ZIP10, ZIP10, ZIP-10, Zrt- and Irt-like protein 10 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC39A10. Peptide sequence HDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDP | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 57181 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title