Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC39A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310021100UL
Description
SLC39A13 Polyclonal specifically detects SLC39A13 in Human samples. It is validated for Western Blot.Specifications
| SLC39A13 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| FLJ25785, LIV-1 subfamily of ZIP zinc transporter 9, LZT-Hs9, solute carrier family 39 (metal ion transporter), member 13, solute carrier family 39 (zinc transporter), member 13, Solute carrier family 39 member 13, zinc transporter ZIP13, ZIP13, ZIP-13, Zrt- and Irt-like protein 13 | |
| The immunogen is a synthetic peptide directed towards the middle region of human SLC39A13 (NP_001121697.1). Peptide sequence GGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAA | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 91252 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction