Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC39A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89


Antigen SLC39A13
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart
View Documents
Novus Biologicals
100 μg
Each for $352.89
Add to cart


SLC39A13 Polyclonal antibody specifically detects SLC39A13 in Human samples. It is validated for Western Blot


Western Blot
PBS buffer, 2% sucrose
Affinity purified
Western Blot 1.0 ug/ml
FLJ25785, LIV-1 subfamily of ZIP zinc transporter 9, LZT-Hs9, solute carrier family 39 (metal ion transporter), member 13, solute carrier family 39 (zinc transporter), member 13, Solute carrier family 39 member 13, zinc transporter ZIP13, ZIP13, ZIP-13, Zrt- and Irt-like protein 13
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A13 (NP_001121697.1). Peptide sequence GGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAA
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit