Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC41A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SLC41A2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159683
|
Novus Biologicals
NBP159683 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
SLC41A2 Polyclonal specifically detects SLC41A2 in Human samples. It is validated for Western Blot.Specifications
SLC41A2 | |
Polyclonal | |
Purified | |
RUO | |
84102 | |
Synthetic peptides corresponding to SLC41A2(solute carrier family 41, member 2) The peptide sequence was selected from the N terminal of SLC41A2. Peptide sequence SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK. | |
Primary | |
53 kDa |
Western Blot | |
Unconjugated | |
Rabbit | |
DKFZP434K0427, MGC125330, MGC125331, SLC41A1-L1, SLC41A1-like 1, solute carrier family 41 member 2, solute carrier family 41, member 2 | |
SLC41A2 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title