Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC41A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SLC41A3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159764
|
Novus Biologicals
NBP159764 |
100 μL |
Each for $436.00
|
|
NBP15976420
|
Novus Biologicals
NBP15976420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SLC41A3 Polyclonal specifically detects SLC41A3 in Human samples. It is validated for Western Blot.Specifications
SLC41A3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ20473, SLC41A1-L2, SLC41A1-like 2, solute carrier family 41 member 3, solute carrier family 41, member 3 | |
SLC41A3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q96GZ6 | |
54946 | |
Synthetic peptides corresponding to SLC41A3(solute carrier family 41, member 3) The peptide sequence was selected from the C terminal of SLC41A3. Peptide sequence WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title