Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC44A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19157120UL
Description
SLC44A3 Polyclonal specifically detects SLC44A3 in Human samples. It is validated for Western Blot.Specifications
SLC44A3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_689582 | |
SLC44A3 | |
Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
choline transporter-like protein 3, member 3, MGC45474, solute carrier family 44, member 3, UNQ558/PRO1115 | |
Rabbit | |
Affinity Purified | |
RUO | |
126969 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction