Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC45A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159786
Description
SLC45A2 Polyclonal specifically detects SLC45A2 in Human samples. It is validated for Western Blot.Specifications
SLC45A2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AIM-1, AIM11A1, MATPmembrane associated transporter, Melanoma antigen AIM1, membrane-associated transporter protein, Protein AIM-1, SHEP5, Solute carrier family 45 member 2, solute carrier family 45, member 2, underwhite | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Pig: 92%; Bovine: 85%; Mouse: 85%; Rat: 85%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6P2P0 | |
SLC45A2 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC45A2. Peptide Sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC. The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Breast Cancer | |
51151 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction