SLC45A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159786

Catalog No. NBP159786

Description

SLC45A2 Polyclonal specifically detects SLC45A2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC45A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AIM-1, AIM11A1, MATPmembrane associated transporter, Melanoma antigen AIM1, membrane-associated transporter protein, Protein AIM-1, SHEP5, Solute carrier family 45 member 2, solute carrier family 45, member 2, underwhite
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Pig: 92%; Bovine: 85%; Mouse: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6P2P0
• Gene Symbols: SLC45A2
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC45A2. Peptide Sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Breast Cancer
• Gene ID (Entrez): 51151
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.