Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC45A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen SLC45A2
Immunogen Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the middle region of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15978620 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15978620UL
20ul Each for $149.00
Add to cart
 
NBP159786 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159786
100 ul Each for $329.00
Add to cart
 
Description

Description

SLC45A2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SLC45A2
Rabbit
Polyclonal
Unconjugated
51151
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the middle region of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
Primary
IgG
AIM-1, AIM11A1, MATPmembrane associated transporter, Melanoma antigen AIM1, membrane-associated transporter protein, Protein AIM-1, SHEP5, Solute carrier family 45 member 2, solute carrier family 45, member 2, underwhite
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit