Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC45A3/Prostein Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP311008100UL
Description
SLC45A3/Prostein Polyclonal specifically detects SLC45A3/Prostein in Mouse samples. It is validated for Western Blot.Specifications
SLC45A3/Prostein | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
IPCA-2, IPCA-6, IPCA-8, PCANAP6IPCA6, PCANAP8, prostate cancer associated protein 2, prostate cancer associated protein 6, prostate cancer associated protein 8, prostate cancer-associated gene 2, prostate cancer-associated gene 6, prostate cancer-associated gene 8, Prostate cancer-associated protein 6, Prostein, PRSTPCANAP2, solute carrier family 45 member 3, solute carrier family 45, member 3 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse SLC45A3/Prostein (NP_001171099.1). Peptide sequence ALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCA | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
85414 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction