SLC5A5/Sodium Iodide Symporter Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159851

Catalog No. NBP159851

Description

SLC5A5/Sodium Iodide Symporter Polyclonal specifically detects SLC5A5/Sodium Iodide Symporter in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC5A5/Sodium Iodide Symporter
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Na(+)/I(-) cotransporter, Na(+)/I(-) symporter, NISNa(+)/I(-)-symporter, sodium/iodide cotransporter, Sodium-iodide symporter, solute carrier family 5 (sodium iodide symporter), member 5, Solute carrier family 5 member 5, TDH1
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q92911
• Gene Symbols: SLC5A5
• Immunogen: Synthetic peptides corresponding to SLC5A5 (solute carrier family 5 (sodium iodide symporter), member 5) The peptide sequence was selected from the N terminal of SLC5A5)(50ug). Peptide sequence TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6528
• Target Species: Human, Mouse, Rat, Equine
• Isotype: IgG