Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC5A5/Sodium Iodide Symporter Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen SLC5A5/Sodium Iodide Symporter
Immunogen Synthetic peptides corresponding to SLC5A5 (solute carrier family 5 (sodium iodide symporter), member 5) The peptide sequence was selected from the N terminal of SLC5A5)(50ug). Peptide sequence TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQ
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1598520 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15985120UL
20ul Each for $149.00
Add to cart
 
NBP159851 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159851
100 ul Each for $329.00
Add to cart
 
Description

Description

SLC5A5/Sodium Iodide Symporter Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.
Specifications

Specifications

SLC5A5/Sodium Iodide Symporter
Rabbit
Polyclonal
Unconjugated
6528
Affinity Purified
Western Blot, Immunohistochemistry
RUO
Synthetic peptides corresponding to SLC5A5 (solute carrier family 5 (sodium iodide symporter), member 5) The peptide sequence was selected from the N terminal of SLC5A5)(50ug). Peptide sequence TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQ
Primary
IgG
Na(+)/I(-) cotransporter, Na(+)/I(-) symporter, NISNa(+)/I(-)-symporter, sodium/iodide cotransporter, Sodium-iodide symporter, solute carrier family 5 (sodium iodide symporter), member 5, Solute carrier family 5 member 5, TDH1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit