Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC7A14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $299.00
Specifications
| Antigen | SLC7A14 |
|---|---|
| Immunogen | Synthetic peptides corresponding to SLC7A14(solute carrier family 7 (cationic amino acid transporter, y+ system), member 14) The peptide sequence was selected from the N terminal of SLC7A14. Peptide sequence VAFFIGWNLILEYLIGTAAGASALSSMFDSL |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15989220 |
Novus Biologicals
NBP15989220UL |
20ul |
Each for $149.00
|
|
NBP159892 |
Novus Biologicals
NBP159892 |
100ul |
Each for $299.00
|
|
Description
SLC7A14 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.Specifications
| SLC7A14 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 57709 | |
| Purified | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| RUO |
| Synthetic peptides corresponding to SLC7A14(solute carrier family 7 (cationic amino acid transporter, y+ system), member 14) The peptide sequence was selected from the N terminal of SLC7A14. Peptide sequence VAFFIGWNLILEYLIGTAAGASALSSMFDSL | |
| Primary | |
| IgG | |
| FLJ37228, KIAA1613Solute carrier family 7 member 14, probable cationic amino acid transporter, solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title