Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC7A14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen SLC7A14
Immunogen Synthetic peptides corresponding to SLC7A14(solute carrier family 7 (cationic amino acid transporter, y+ system), member 14) The peptide sequence was selected from the N terminal of SLC7A14. Peptide sequence VAFFIGWNLILEYLIGTAAGASALSSMFDSL
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15989220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15989220UL
20ul Each for $149.00
Add to cart
 
NBP159892 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159892
100ul Each for $299.00
Add to cart
 
Description

Description

SLC7A14 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

SLC7A14
Rabbit
Polyclonal
Unconjugated
57709
Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
RUO
Synthetic peptides corresponding to SLC7A14(solute carrier family 7 (cationic amino acid transporter, y+ system), member 14) The peptide sequence was selected from the N terminal of SLC7A14. Peptide sequence VAFFIGWNLILEYLIGTAAGASALSSMFDSL
Primary
IgG
FLJ37228, KIAA1613Solute carrier family 7 member 14, probable cationic amino acid transporter, solute carrier family 7 (cationic amino acid transporter, y+ system), member 14
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit