Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC7A7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | SLC7A7 |
|---|---|
| Immunogen | Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQG |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15985620 |
Novus Biologicals
NBP15985620UL |
20ul |
Each for $149.00
|
|
NBP159856 |
Novus Biologicals
NBP159856 |
100 ul |
Each for $329.00
|
|
Description
SLC7A7 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| SLC7A7 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 9056 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQG | |
| Primary | |
| IgG | |
| LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title