Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC9A7 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SLC9A7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179719
|
Novus Biologicals
NBP179719 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SLC9A7 Polyclonal specifically detects SLC9A7 in Mouse samples. It is validated for Western Blot.Specifications
| SLC9A7 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Na(+)/H(+) exchanger 7, NHE-7, NHE7SLC9A6, nonselective sodium potassium/proton exchanger, sodium/hydrogen exchanger 7, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 7, solute carrier family 9 (sodium/hydrogen exchanger), member 7, Solute carrier family 9 member 7 | |
| SLC9A7 | |
| IgG | |
| Affinity Purified | |
| 80 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_796327 | |
| 84679 | |
| The immunogen for this antibody is Slc9a7. Peptide sequence SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title