Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLCO1C1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen SLCO1C1
Immunogen Synthetic peptides corresponding to SLCO1C1(solute carrier organic anion transporter family, member 1C1) The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15964220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15964220UL
20ul Each for $149.00
Add to cart
 
NBP159642 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159642
100 ul Each for $329.00
Add to cart
 
Description

Description

SLCO1C1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SLCO1C1
Rabbit
Polyclonal
Unconjugated
53919
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SLCO1C1(solute carrier organic anion transporter family, member 1C1) The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ.
Primary
IgG
OATP1, OATP14Thyroxine transporter, OATP1C1Solute carrier family 21 member 14, OATPFOAT-RP-5, OATP-FOrganic anion-transporting polypeptide 14, OATPRP5, Organic anion transporter F, Organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, SLC21A14OATP-14, solute carrier family 21 (organic anion transporter), member 14, solute carrier organic anion transporter family member 1C1, solute carrier organic anion transporter family, member 1C1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit