Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLCO3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26883825UL
Description
SLCO3A1 Polyclonal antibody specifically detects SLCO3A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SLCO3A1 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM | |
25 μL | |
Cell Biology, Neuroscience, Signal Transduction | |
28232 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction