SLCO6A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159898

Catalog No. NBP159898

Description

SLCO6A1 Polyclonal specifically detects SLCO6A1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLCO6A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 48, CT48Organic anion-transporting polypeptide I, Gonad-specific transporter, GSTOATP-I, MGC26949, OATP6A1Solute carrier family 21 member 19, OATPY, Organic anion-transporting polypeptide 6A1, SLC21A19, solute carrier organic anion transporter family member 6A1, solute carrier organic anion transporter family, member 6A1, testis-specific organic anion transporter
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 133482
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86UG4
• Gene Symbols: SLCO6A1
• Immunogen: Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the N terminal of SLCO6A1. Peptide sequence CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Form: Purified