Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLCO6A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen SLCO6A1
Immunogen Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the N terminal of SLCO6A1. Peptide sequence CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15989820 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15989820UL
20ul Each for $149.00
Add to cart
 
NBP159898 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159898
100ul Each for $299.00
Add to cart
 
Description

Description

SLCO6A1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SLCO6A1
Rabbit
Polyclonal
Unconjugated
133482
Purified
Western Blot
RUO
Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the N terminal of SLCO6A1. Peptide sequence CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS.
Primary
IgG
Cancer/testis antigen 48, CT48Organic anion-transporting polypeptide I, Gonad-specific transporter, GSTOATP-I, MGC26949, OATP6A1Solute carrier family 21 member 19, OATPY, Organic anion-transporting polypeptide 6A1, SLC21A19, solute carrier organic anion transporter family member 6A1, solute carrier organic anion transporter family, member 6A1, testis-specific organic anion transporter
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit